Anti-SLC38A9
Artikelnummer:
ATA-HPA043785
- Bilder (9)
| Artikelname: | Anti-SLC38A9 |
| Artikelnummer: | ATA-HPA043785 |
| Hersteller Artikelnummer: | HPA043785 |
| Alternativnummer: | ATA-HPA043785-100,ATA-HPA043785-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ90709 |
| solute carrier family 38, member 9 |
| Anti-SLC38A9 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 153129 |
| UniProt: | Q8NBW4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC38A9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemical staining of human placenta shows strong granular cytoplasmic positivity in a subset of trophoblastic cells. |
|
|
Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity as expected. |
|
|
HPA043785-100ul |
|
|
|
|
|
HPA043785-100ul |
|
|
HPA043785-100ul |
Produktgarantie und fachkundiger Support
