Anti-ARHGEF18
Artikelnummer:
ATA-HPA042689
- Bilder (9)
| Artikelname: | Anti-ARHGEF18 |
| Artikelnummer: | ATA-HPA042689 |
| Hersteller Artikelnummer: | HPA042689 |
| Alternativnummer: | ATA-HPA042689-100,ATA-HPA042689-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0521, MGC15913, P114-RhoGEF |
| Rho/Rac guanine nucleotide exchange factor (GEF) 18 |
| Anti-ARHGEF18 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23370 |
| UniProt: | Q6ZSZ5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ARHGEF18 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in Kupffer cells. |
|
|
HPA042689-100ul |
|
|
|
|
|
HPA042689-100ul |
|
|
HPA042689-100ul |
Produktgarantie und fachkundiger Support
