Anti-ADNP

Artikelnummer: ATA-HPA006371
Artikelname: Anti-ADNP
Artikelnummer: ATA-HPA006371
Hersteller Artikelnummer: HPA006371
Alternativnummer: ATA-HPA006371-100,ATA-HPA006371-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ADNP1, KIAA0784
activity-dependent neuroprotector homeobox
Anti-ADNP
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 23394
UniProt: Q9H2P0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SGSPFDPVFEVEPKISNDNPEEHVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQDDVVEWKDGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQGDREQLKWKNSSYGKVEG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ADNP
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human stomach shows strong nuclear and moderate cytoplasmic positivity in glandular cells.
Western blot analysis in human cell line SH-SY5Y.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA006371-100ul
HPA006371-100ul
HPA006371-100ul