Anti-NR2C2
Artikelnummer:
ATA-HPA006313
| Artikelname: |
Anti-NR2C2 |
| Artikelnummer: |
ATA-HPA006313 |
| Hersteller Artikelnummer: |
HPA006313 |
| Alternativnummer: |
ATA-HPA006313-100,ATA-HPA006313-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ICC, IHC, WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
hTAK1, TAK1, TR2R1, TR4 |
| nuclear receptor subfamily 2, group C, member 2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.1 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
7182 |
| UniProt: |
P49116 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
DGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMP |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
NR2C2 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
Immunohistochemical staining of human endometrium shows nuclear positivity in glandular cells and cels in the endometrial stroma. |
|
Western blot analysis in human cell line HeLa. |
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
HPA006313-100ul |
|
|
|
|
|
HPA006313-100ul |
|
HPA006313-100ul |