DUOXA2 Antibody
Artikelnummer:
ASB-ARP64802_P050
- Bilder (3)
| Artikelname: | DUOXA2 Antibody |
| Artikelnummer: | ASB-ARP64802_P050 |
| Hersteller Artikelnummer: | ARP64802_P050 |
| Alternativnummer: | ASB-ARP64802_P050-25UL,ASB-ARP64802_P050-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Proteine/Peptide |
| Applikation: | IHC |
| Spezies Reaktivität: | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence RWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARV |
| Alternative Synonym: | TDH5, SIMNIPHOM |
| This gene encodes an endoplasmic reticulum protein that is necessary for proper cellular localization and maturation of functional dual oxidase 2. Mutations in this gene have been associated with thyroid dyshormonogenesis 5. |
|
|
Rabbit Anti-DUOXA2 antibody Catalog Number: ARP64802 Formalin Fixed Paraffin Embedded Tissue: Human Adrenal Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
Rabbit Anti-DUOXA2 antibody Catalog Number: ARP64802 Formalin Fixed Paraffin Embedded Tissue: Human Colon Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
DUOXA2 Antibody (ARP64802_P050) in Human Adrenal using Immunohistochemistry |
Produktgarantie und fachkundiger Support
