Anti-APOE Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89435-100
Artikelname: Anti-APOE Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89435-100
Hersteller Artikelnummer: A89435-100
Alternativnummer: ABC-A89435-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to amino acids 211-311 of mouse APOE.
Konjugation: Unconjugated
Rabbit polyclonal antibody to APOE.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 33 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% ProClin 300.
Formulierung: Liquid
Sequenz: QPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
Target-Kategorie: APOE
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ELISA: 1 µg/ml (starting concentration)