Anti-Fbx32 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80674-100
Artikelname: Anti-Fbx32 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80674-100
Hersteller Artikelnummer: A80674-100
Alternativnummer: ABC-A80674-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, ICC
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A recombinant fusion protein corresponding to amino acids 206-355 of human Fbx32.
Konjugation: Unconjugated
Rabbit polyclonal antibody to Fbx32.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 42 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% ProClin 300.
Formulierung: Liquid
Sequenz: WQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
Target-Kategorie: Fbx32
Antibody Type: Primary Antibody
Application Verdünnung: ICC/IF: 1:50-1:200