Anti-RNA polymerase II CTD repeat YSPTSPS Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80664-100
Artikelname: Anti-RNA polymerase II CTD repeat YSPTSPS Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80664-100
Hersteller Artikelnummer: A80664-100
Alternativnummer: ABC-A80664-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human POLR2A (NP_000928.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to RNA polymerase II CTD repeat YSPTSPS.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 250 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: KRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAG
Target-Kategorie: RNA polymerase II CTD repeat YSPTSPS
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:200, ChIP: 1:20-1:50