Anti-NKCC1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80631-100
Artikelname: Anti-NKCC1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80631-100
Hersteller Artikelnummer: A80631-100
Alternativnummer: ABC-A80631-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 201-280 of human SLC12A2 (NP_001037.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NKCC1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 160 - 200 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: YDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESK
Target-Kategorie: NKCC1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200