Anti-FKBP12 Antibody [ARC0654], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A80626-100
Artikelname: Anti-FKBP12 Antibody [ARC0654], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A80626-100
Hersteller Artikelnummer: A80626-100
Alternativnummer: ABC-A80626-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 29-108 of human FKBP12 (P62942).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0654] antibody to FKBP12.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0654]
Molekulargewicht: 14 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: GMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Target-Kategorie: FKBP12
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000