Anti-SYNPO2L Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80566-100
Artikelname: Anti-SYNPO2L Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80566-100
Hersteller Artikelnummer: A80566-100
Alternativnummer: ABC-A80566-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human SYNPO2L (NP_001107605.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SYNPO2L.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 71 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: HVTPKTPPPMAPKTPPPMTPKTPPPVAPKPPSRGLLDGLVNGAASSAGIPEPPRLQGRGGELFAKRQSRADRYVVEGTPGPGLGPRPRSPSPTPSLPPSWK
Target-Kategorie: SYNPO2L
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000