Anti-Amyloid Precursor Protein Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80556-100
Artikelname: Anti-Amyloid Precursor Protein Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80556-100
Hersteller Artikelnummer: A80556-100
Alternativnummer: ABC-A80556-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human APP (NP_000475.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Amyloid Precursor Protein.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 100 - 140 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKR
Target-Kategorie: Amyloid Precursor Protein
Antibody Type: Primary Antibody
Application Verdünnung: ICC/IF: 1:50-1:200