Anti-Aconitase 1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80555-100
Artikelname: Anti-Aconitase 1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80555-100
Hersteller Artikelnummer: A80555-100
Alternativnummer: ABC-A80555-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to amino acids 100-200 of human Aconitase 1.
Konjugation: Unconjugated
Rabbit polyclonal antibody to Aconitase 1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 100 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDS
Target-Kategorie: Aconitase 1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000