Anti-Bcl3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80546-100
Artikelname: Anti-Bcl3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80546-100
Hersteller Artikelnummer: A80546-100
Alternativnummer: ABC-A80546-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human BCL3 (NP_005169.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Bcl3.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 60 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: ANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPS
Target-Kategorie: Bcl3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200