Anti-Aquaporin 4 Antibody [ARC54345], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A80530-100
Artikelname: Anti-Aquaporin 4 Antibody [ARC54345], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A80530-100
Hersteller Artikelnummer: A80530-100
Alternativnummer: ABC-A80530-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 256-323 of human Aquaporin-4 (AQP4) (NP_001641.1).
Konjugation: Unconjugated
Rabbit monoclonal [ARC54345] antibody to Aquaporin 4.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC54345]
Molekulargewicht: 30 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: VEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Target-Kategorie: Aquaporin 4
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200