Anti-ERK2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80506-100
Artikelname: Anti-ERK2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80506-100
Hersteller Artikelnummer: A80506-100
Alternativnummer: ABC-A80506-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK2 (NP_620407.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ERK2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 42 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
Target-Kategorie: ERK2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200