Anti-STAT6 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80451-100
Artikelname: Anti-STAT6 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80451-100
Hersteller Artikelnummer: A80451-100
Alternativnummer: ABC-A80451-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human STAT6 (NP_003144.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to STAT6.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 110 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: LLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTV
Target-Kategorie: STAT6
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200