Anti-Ki67 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80435-100
Artikelname: Anti-Ki67 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80435-100
Hersteller Artikelnummer: A80435-100
Alternativnummer: ABC-A80435-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Ki67 (NP_001139438.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Ki67.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 359 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: GDGKSIRTFKESPKQILDPAARVTGMKKWPRTPKEEAQSLEDLAGFKELFQTPGPSEESMTDEKTTKIACKSPPPESVDTPTSTKQWPKRSLRKADVEEEF
Target-Kategorie: Ki67
Antibody Type: Primary Antibody
Application Verdünnung: ICC/IF: 1:50-1:200