Anti-SLC27A6/FATP6 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10337-100
Artikelname: Anti-SLC27A6/FATP6 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10337-100
Hersteller Artikelnummer: A10337-100
Alternativnummer: ABC-A10337-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 370-619 of human SLC27A6 (NP_054750.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SLC27A6/FATP6.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 70 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: FMNYTGRIGAIGRTNLFYKLLSTFDLIKYDFQKDEPMRNEQGWCIHVKKGEPGLLISRVNAKNPFFGYAGPYKHTKDKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRTGDTFRWKGENVATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEKVYEQVVTFLPAYACPRFLRIQEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKSYVLLTRELYDQIMLGEIKL
Target-Kategorie: SLC27A6/FATP6
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000