SMMHC/MYH11 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A4064
- Bilder (9)
| Artikelname: | SMMHC/MYH11 Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A4064 |
| Hersteller Artikelnummer: | A4064 |
| Alternativnummer: | ABB-A4064-100UL,ABB-A4064-20UL,ABB-A4064-500UL,ABB-A4064-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AAT4, FAA4, SMHC, SMMHC, VSCM2, SMMS-1, SMMHC/MYH11 |
| The protein encoded by this gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. It functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. A chromosomal rearrangement involving this gene is associated with acute myeloid leukemia of the M4Eo subtype. Mutations in this gene are associated with visceral myopathy, megacystis-microcolon-intestinal hypoperistalsis syndrome 2, and familial thoracic aortic aneurysm 4. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC51911] |
| Molekulargewicht: | 227kDa |
| NCBI: | 4629 |
| UniProt: | P35749 |
| Reinheit: | Affinity purification |
| Sequenz: | DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL |
| Target-Kategorie: | MYH11 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|IF-F,1:200 - 1:600|IF-P,1:400 - 1:1600|IHC-P,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Motor Proteins,Stem Cells,Cardiovascular,Heart,Contractility. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Human lung tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human breast tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Western blot analysis of lysates from Rat uterus using SMMHC/MYH11 Rabbit mAb (A4064) at 1:1000 dilution incubated at room temperature for 1.5 hours. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1 s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using SMMHC/MYH11 Rabbit mAb (A4064) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Confocal imaging ofparaffin-embedded Rat small intestine usingSMMHC/MYH11 Rabbit mAb (A4064,dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining. |
|
|
Confocal imaging ofparaffin-embedded Human colon usingSMMHC/MYH11 Rabbit mAb (A4064,dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining. |
|
|
Confocal imaging ofparaffin-embedded Human colon usingSMMHC/MYH11 Rabbit mAb (A4064,dilution 1:800) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining. |
Produktgarantie und fachkundiger Support
