RB Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A28031
- Bilder (8)
| Artikelname: | RB Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A28031 |
| Hersteller Artikelnummer: | A28031 |
| Alternativnummer: | ABB-A28031-100UL,ABB-A28031-1000UL,ABB-A28031-500UL,ABB-A28031-20UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, IP, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RB, pRb, OSRC, pp110, p105-Rb, PPP1R130, p110-RB1 |
| The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma. |
| Klonalität: | Monoclonal |
| Molekulargewicht: | 106kDa |
| NCBI: | 5925 |
| UniProt: | P06400 |
| Reinheit: | Affinity purification |
| Sequenz: | DQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK |
| Target-Kategorie: | RB1 |
| Application Verdünnung: | WB,1:20000 - 1:80000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,DNA Damage Repair,Protein phosphorylation,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors,Cell Cycle Control-G1 S Checkpoint. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Jurkat cells using RB Rabbit mAb (A28031) at 1:80000 dilution incubated at room temperature for 1.5 hours. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human cervix tissue using RB Rabbit mAb (A28031) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using RB Rabbit mAb (A28031) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using RB Rabbit mAb (A28031) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using RB Rabbit mAb (A28031) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using RB Rabbit mAb (A28031) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using RB Rabbit mAb (A28031) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunoprecipitation of RB from 300 µg extracts of Raji cells was performed using 2 µg of RB Rabbit mAb (A28031). Rabbit Control IgG (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using RB Rabbit mAb (A28031) at a dilution of 1:5000. |
Produktgarantie und fachkundiger Support
