ZBP1 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A27798
- Bilder (8)
| Artikelname: | ZBP1 Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A27798 |
| Hersteller Artikelnummer: | A27798 |
| Alternativnummer: | ABB-A27798-100UL,ABB-A27798-1000UL,ABB-A27798-20UL,ABB-A27798-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, IP, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DAI, DLM1, DLM-1, C20orf183 |
| This gene encodes a Z-DNA binding protein. The encoded protein plays a role in the innate immune response by binding to foreign DNA and inducing type-I interferon production. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Klonalität: | Monoclonal |
| Molekulargewicht: | 46kDa |
| NCBI: | 81030 |
| UniProt: | Q9H171 |
| Reinheit: | Affinity purification |
| Sequenz: | MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYRPEDS |
| Target-Kategorie: | ZBP1 |
| Application Verdünnung: | WB,1:10000 - 1:60000|IP,0.5µg-4µg antibody for 500µg-700µg extracts of whole cells|IF/ICC,1:100 - 1:400|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ZBP1 Rabbit mAb (A27798) at 1:11000 dilutionincubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Negative control (NC): A549 Exposure time: 1s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using ZBP1 Rabbit mAb (A27798) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using ZBP1 Rabbit mAb (A27798) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using ZBP1 Rabbit mAb (A27798) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using ZBP1 Rabbit mAb (A27798) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Confocal imaging of U266 cells (postive) and A549 cells (negative) using ZBP1 Rabbit mAb (A27798, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x. |
|
|
Immunoprecipitation of ZBP1 from 600 µg extracts of U266 cells was performed using 1 µg of ZBP1 Rabbit mAb (A27798). Rabbit IgG isotype control (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X non-reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using ZBP1 Rabbit mAb (A27798) at a dilution of 1:3000. |
|
|
Immunoprecipitation of ZBP1 from 600 µg extracts of U266 cells was performed using 1 µg of ZBP1 Rabbit mAb (A27798). Rabbit IgG isotype control (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X non-reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using ZBP1 Rabbit mAb (A27798) at a dilution of 1:3000. |
Produktgarantie und fachkundiger Support
