Ferredoxin Reductase Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A27716
- Bilder (8)
| Artikelname: | Ferredoxin Reductase Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A27716 |
| Hersteller Artikelnummer: | A27716 |
| Alternativnummer: | ABB-A27716-500UL,ABB-A27716-100UL,ABB-A27716-20UL,ABB-A27716-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ADR, ADXR, ANOA |
| This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants have been found for this gene. |
| Klonalität: | Monoclonal |
| Molekulargewicht: | 54kDa |
| NCBI: | 2232 |
| UniProt: | P22570 |
| Reinheit: | Affinity purification |
| Sequenz: | EIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCS |
| Target-Kategorie: | FDXR |
| Application Verdünnung: | WB,1:5000 - 1:30000|IF/ICC,1:100 - 1:200|IF-P,1:100 - 1:200|IHC-P,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Ferredoxin Reductase Rabbit mAb (A27716) at 1:5000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
|
|
Western blot analysis of lysates from Rat testis using Ferredoxin Reductase Rabbit mAb (A27716) at 1:5000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using Ferredoxin Reductase Rabbit mAb (A27716) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Ferredoxin Reductase Rabbit mAb (A27716) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human fallopian tube tissue using Ferredoxin Reductase Rabbit mAb (A27716) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human testis tissue using Ferredoxin Reductase Rabbit mAb (A27716) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Confocal imaging of U-2 OS cells using Ferredoxin Reductase Rabbit mAb (A27716, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x. |
|
|
Confocal imaging of paraffin-embedded Mouse testis tissue using Ferredoxin Reductase Rabbit mAb (A27716, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
Produktgarantie und fachkundiger Support
