[KO Validated] HIF1AN/FIH-1 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A27299
- Bilder (8)
| Artikelname: | [KO Validated] HIF1AN/FIH-1 Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A27299 |
| Hersteller Artikelnummer: | A27299 |
| Alternativnummer: | ABB-A27299-500UL,ABB-A27299-100UL,ABB-A27299-20UL,ABB-A27299-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FIH1 |
| Enables several functions, including 2-oxoglutarate-dependent dioxygenase activity, NF-kappaB binding activity, and transition metal ion binding activity. Involved in several processes, including negative regulation of Notch signaling pathway, negative regulation of transcription from RNA polymerase II promoter in response to hypoxia, and protein hydroxylation. Located in cytosol, nucleoplasm, and perinuclear region of cytoplasm. Colocalizes with nucleus. |
| Klonalität: | Monoclonal |
| Molekulargewicht: | 41kDa |
| NCBI: | 55662 |
| UniProt: | Q9NWT6 |
| Reinheit: | Affinity purification |
| Sequenz: | MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNF |
| Target-Kategorie: | HIF1AN |
| Application Verdünnung: | WB,1:8000 - 1:32000|IHC-P,1:100 - 1:400|IF/ICC,1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Invasion and Metastasis,Cardiovascular,Hypoxia. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type (WT) and HIF1AN/FIH-1 knockout (KO) 293T cells using [KO Validated] HIF1AN/FIH-1 Rabbit mAb (A27299) at 1:16000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using [KO Validated] HIF1AN/FIH-1 Rabbit mAb (A27299) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates using [KO Validated] HIF1AN/FIH-1 Rabbit mAb (A27299) at 1:16000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KO Validated] HIF1AN/FIH-1 Rabbit mAb (A27299) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using [KO Validated] HIF1AN/FIH-1 Rabbit mAb (A27299) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using [KO Validated] HIF1AN/FIH-1 Rabbit mAb (A27299) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded 293T and 293T-HIF1AN-KO cells using [KO Validated] HIF1AN/FIH-1 Rabbit mAb (A27299) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Confocal imaging of NIH/3T3 cells using [KO Validated] HIF1AN/FIH-1 Rabbit mAb (A27299, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x. |
Produktgarantie und fachkundiger Support
