[KD Validated] eIF4E Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A25608
Artikelname: [KD Validated] eIF4E Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A25608
Hersteller Artikelnummer: A25608
Alternativnummer: ABB-A25608-100UL,ABB-A25608-500UL,ABB-A25608-20UL,ABB-A25608-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CBP, EIF4F, AUTS19, EIF4E1, eIF-4E, EIF4EL1
The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5 end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants.
Klonalität: Monoclonal
Molekulargewicht: 25kDa/27kDa/29kDa
NCBI: 1977
UniProt: P06730
Reinheit: Affinity purification
Sequenz: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEP
Target-Kategorie: EIF4E
Application Verdünnung: WB,1:3000 - 1:18000|IF/ICC,1:200 - 1:2000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat,Monkey. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Signal Transduction,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using [KD Validated] eIF4E Rabbit mAb (A25608) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:10s.
Western blot analysis of various lysates using [KD Validated] eIF4E Rabbit mAb (A25608) at 1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of lysates from wild type (WT) and eIF4E knockdown (KD)293T cellsusing[KD Validated] eIF4E Rabbit mAb (A25608) at1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:1s.
Confocal imaging of 293T cells using[KD Validated] eIF4E Rabbit mAb (A25608, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of Hep G2 cells using[KD Validated] eIF4E Rabbit mAb (A25608, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of NIH/3T3 cells using[KD Validated] eIF4E Rabbit mAb (A25608, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of PC-12 cells using[KD Validated] eIF4E Rabbit mAb (A25608, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Immunoprecipitation of [KD Validated] eIF4E in 200 µg extracts from 293T cells using 0.5 µg [KD Validated] eIF4E Rabbit mAb (A25608). Western blot analysis was performed using [KD Validated] eIF4E Rabbit mAb (A25608) at 1:3000 dilution.