CD326/EpCAM Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A25344
Artikelname: CD326/EpCAM Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A25344
Hersteller Artikelnummer: A25344
Alternativnummer: ABB-A25344-100UL,ABB-A25344-20UL,ABB-A25344-1000UL,ABB-A25344-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: EGP, Ly74, gp40, CD326, EGP-2, TROP1, Egp314, Ep-CAM, EpCAM1, Tacsd1, GA733-2, Tacstd1
Predicted to enable cadherin binding activity involved in cell-cell adhesion. Acts upstream of or within ureteric bud development. Located in cell surface. Is expressed in several structures, including alimentary system, central nervous system, genitourinary system, respiratory system, and sensory organ. Used to study congenital diarrhea 5 with tufting enteropathy. Human ortholog(s) of this gene implicated in congenital diarrhea 5 with tufting enteropathy and hereditary nonpolyposis colorectal cancer type 8. Orthologous to human EPCAM (epithelial cell adhesion molecule).
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC65853]
Molekulargewicht: 35 kDa
NCBI: 17075
UniProt: Q99JW5
Reinheit: Affinity purification
Sequenz: QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT
Target-Kategorie: Epcam
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:3000 - 1:12000|IF-P,1:200 - 1:2000|IHC-P,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.,
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Tags & Cell Markers, Cell Type Markers, Tumor Associated. Shipping: Ice Bag
Western blot analysis of lysates from HCT 116 cells using CD326/EpCAM Rabbit mAb (A25344) at 1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45 s.
Immunohistochemistry analysis of paraffin-embeddedHuman kidney tissue usingCD326/EpCAM Rabbit mAb(A25344) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates usingCD326/EpCAM Rabbit mAb (A25344) at1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):C2C12.
Exposure time:20 s.
Immunohistochemistry analysis of paraffin-embeddedHuman colon carcinoma tissue usingCD326/EpCAM Rabbit mAb(A25344) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman small intestine tissue usingCD326/EpCAM Rabbit mAb(A25344) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Confocal imaging ofparaffin-embedded Mouse small intestine tissue usingCD326/EpCAM Rabbit mAb (A25344, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Mouse colon tissue using CD326/EpCAM Rabbit mAb (A25344, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Rat small intestine tissue using CD326/EpCAM Rabbit mAb (A25344, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.