FLNB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A2481
Artikelname: FLNB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A2481
Hersteller Artikelnummer: A2481
Alternativnummer: ABB-A2481-100UL,ABB-A2481-20UL,ABB-A2481-500UL,ABB-A2481-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AOI, FH1, SCT, TAP, LRS1, TABP, FLN-B, FLN1L, ABP-278, ABP-280, FLNB
This gene encodes a member of the filamin family. The encoded protein interacts with glycoprotein Ib alpha as part of the process to repair vascular injuries. The platelet glycoprotein Ib complex includes glycoprotein Ib alpha, and it binds the actin cytoskeleton. Mutations in this gene have been found in several conditions: atelosteogenesis type 1 and type 3, boomerang dysplasia, autosomal dominant Larsen syndrome, and spondylocarpotarsal synostosis syndrome. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
Klonalität: Polyclonal
Molekulargewicht: 278kDa
NCBI: 2317
UniProt: O75369
Reinheit: Affinity purification
Sequenz: PDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFA
Target-Kategorie: FLNB
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|IF/ICC,1:20 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Actins. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Rat heart using FLNB Rabbit pAb (A2481) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver damage using FLNB Rabbit pAb (A2481) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Western blot analysis of various lysates using FLNB Rabbit pAb (A2481) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Basic Kit (RM00020)._Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human prostate using FLNB Rabbit pAb (A2481) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of HeLa cells using FLNB Rabbit pAb (A2481) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HUVEC cells using FLNB Rabbit pAb (A2481) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using FLNB Rabbit pAb (A2481) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using FLNB Rabbit pAb (A2481) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.