c-Fos Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A24620
Artikelname: c-Fos Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A24620
Hersteller Artikelnummer: A24620
Alternativnummer: ABB-A24620-20UL,ABB-A24620-100UL,ABB-A24620-1000UL,ABB-A24620-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: p55, AP-1, C-FOS, c-Fos
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC63309]
Molekulargewicht: 41kDa
NCBI: 2353
UniProt: P01100
Reinheit: Affinity purification
Sequenz: GFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPS
Target-Kategorie: FOS
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:4000|IF-P,1:200 - 1:400|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Tumor biomarkers,Signal Transduction,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Immunology Inflammation,T Cell Receptor Signaling Pathway,Neuroscience, Cell Type Marker,Neuron marker. Shipping: Ice Bag
Western blot analysis of lysates from PC-12 cells using c-Fos Rabbit mAb (A24620) at 1:1000 dilutionincubated overnight at 4°C. PC-12 cells were treated with PMA(200 nM) at 37°C for 30 minutes after serum-starvation overnight.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of lysates from HeLa cells using c-Fos Rabbit mAb (A24620) at 1:1000 dilutionincubated overnight at 4°C. HeLa cells were treated with PMA(200 nM) at 37°C for 30 minutes after serum-starvation overnight.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
Western blot analysis of lysates from NIH/3T3 cells using c-Fos Rabbit mAb (A24620) at 1:1000 dilutionincubated overnight at 4°C. NIH/3T3 cells were treated with PMA(200 nM) at 37°C for 30 minutes after serum-starvation overnight.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
Immunohistochemistry analysis of paraffin-embedded Human cervix using c-Fos Rabbit mAb (A24620) at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon using c-Fos Rabbit mAb (A24620) at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Mouse brain tissue using c-Fos Rabbit mAb (A24620, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Mouse colon tissue using c-Fos Rabbit mAb (A24620, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Rat brain tissue using c-Fos Rabbit mAb (A24620, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.