KDM1/LSD1 Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A24121
Artikelname: KDM1/LSD1 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A24121
Hersteller Artikelnummer: A24121
Alternativnummer: ABB-A24121-100UL,ABB-A24121-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AOF2, CPRF, KDM1, LSD1, BHC110, KDM1/LSD1
This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC64841]
Molekulargewicht: 93kDa
NCBI: 23028
UniProt: O60341
Reinheit: Affinity purification
Sequenz: EPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPT
Target-Kategorie: KDM1A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|IF/ICC,1:200 - 1:800|IF-P,1:200 - 1:800|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat,Monkey. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Transcription Factors. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embeddedRat colon tissue usingKDM1/LSD1 Rabbit mAb(A24121) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedRat brain tissue usingKDM1/LSD1 Rabbit mAb(A24121) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates using KDM1/LSD1 Rabbit mAb (A24121) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.
Immunohistochemistry analysis of paraffin-embeddedMouse testis tissue usingKDM1/LSD1 Rabbit mAb(A24121) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedMouse intestin tissue usingKDM1/LSD1 Rabbit mAb(A24121) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedMouse brain tissue usingKDM1/LSD1 Rabbit mAb(A24121) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman cervix cancer tissue usingKDM1/LSD1 Rabbit mAb(A24121) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Confocal imaging of U-2 OS cells usingKDM1/LSD1 Rabbit mAb (A24121,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging ofparaffin-embedded human breast cancer usingKDM1/LSD1 Rabbit mAb (A24121,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.