Acetyl-Histone H4-K16 Rabbit mAb, Unconjugated
Artikelnummer:
ABB-A23091
- Bilder (8)
| Artikelname: | Acetyl-Histone H4-K16 Rabbit mAb, Unconjugated |
| Artikelnummer: | ABB-A23091 |
| Hersteller Artikelnummer: | A23091 |
| Alternativnummer: | ABB-A23091-100UL,ABB-A23091-500UL,ABB-A23091-20UL,ABB-A23091-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, DOT, ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4FA, H4-16, H4C11, H4C12, H4C13, H4C14, H4C15, H4C16, HIST1H4A, Acetyl-Histone H4-K16 |
| Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC55790] |
| Molekulargewicht: | 11 kDa |
| NCBI: | 8359 |
| UniProt: | P62805 |
| Reinheit: | Affinity purification |
| Sequenz: | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG |
| Target-Kategorie: | Histone H4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:10000-1:40000|DB,1:100 - 1:500|IHC-P,1:2000 - 1:8000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.|ChIP,5µg antibody for 5µg-10µg of Chromatin |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted). ResearchArea: Protein phosphorylation,Cell Biology Developmental Biology,Cell Cycle, Epigenetics & Nuclear Signaling,Epigenetic Modifications,Methylation. Shipping: Ice Bag |
|
|
Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at 1:500 dilution. |
|
|
Immunohistochemistry analysis of paraffin-embedded Moue pancreas tissue using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at 1:20000 dilutionincubated overnight at 4°C. HeLa cells, NIH/3T3 cells and C6 cells were treated with TSA (1 uM) at 37°C for 18 hours. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 30 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10 s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H4-K16 Rabbit mAb (A23091) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H4-K16 antibody (A23091) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input. |
Produktgarantie und fachkundiger Support
