Acetyl-Histone H3-K27 Rabbit mAb, Unconjugated
Artikelnummer:
ABB-A22264
- Bilder (8)
| Artikelname: | Acetyl-Histone H3-K27 Rabbit mAb, Unconjugated |
| Artikelnummer: | ABB-A22264 |
| Hersteller Artikelnummer: | A22264 |
| Alternativnummer: | ABB-A22264-20UL,ABB-A22264-100UL,ABB-A22264-1000UL,ABB-A22264-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, DOT, ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | H3t, H3.4, H3/g, H3FT, H3C16, HIST3H3, Acetyl-Histone H3-K27 |
| Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails, instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC54943] |
| Molekulargewicht: | 15 kDa |
| NCBI: | 8290 |
| UniProt: | Q16695 |
| Reinheit: | Affinity purification |
| Sequenz: | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
| Target-Kategorie: | H3C1/H3-4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:10000 - 1:40000|DB,1:2000 - 1:20000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.|ChIP,5µg antibody for 5µg-10µg of Chromatin|C |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted). ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Signal Transduction,MAPK-Erk Signaling Pathway. Shipping: Ice Bag |
|
|
Dot-blot analysis of all sorts of peptides using Acetyl-Histone H3-K27 antibody (A22264) at 1:2000 dilution. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human lung using Acetyl-Histone H3-K27 Rabbit mAb (A22264) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates using Acetyl-Histone H3-K27 Rabbit mAb (A22264) at 1:10000 dilutionincubated overnight at 4°C. HeLa cells ,NIH/3T3 cells and C6 cells were treated with TSA (1 µM) at 37°C for 18 hours. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 30 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human spleen using Acetyl-Histone H3-K27 Rabbit mAb (A22264) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat intestine using Acetyl-Histone H3-K27 Rabbit mAb (A22264) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Confocal imaging of HeLa TSA and HeLa cells usingAcetyl-Histone H3-K27 Rabbit mAb (A22264,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 100x. |
|
|
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H3-K27 antibody (A22264) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input. |
|
|
Chromatin immunoprecipitations were performed with cross-linked chromatin from HeLa cells and Acetyl-Histone H3-K27 Rabbit mAb (A22264). The ChIP sequencing results indicate the enrichment pattern of Acetyl-Histone H3-K27 in selected genomic region and representative gene loci (RPL30), as shown in figure. |
Produktgarantie und fachkundiger Support
