Cullin 1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2136
- Bilder (8)
| Artikelname: | Cullin 1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2136 |
| Hersteller Artikelnummer: | A2136 |
| Alternativnummer: | ABB-A2136-20UL,ABB-A2136-100UL,ABB-A2136-1000UL,ABB-A2136-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Cullin 1, CUL1, cullin-1, MGC149834, MGC149835 |
| Predicted to enable ubiquitin protein ligase binding activity and ubiquitin-protein transferase activity. Involved in SCF-dependent proteasomal ubiquitin-dependent protein catabolic process and protein ubiquitination. Located in plasma membrane. Part of Parkin-FBXW7-Cul1 ubiquitin ligase complex and SCF ubiquitin ligase complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 90kDa |
| NCBI: | 8454 |
| UniProt: | Q13616 |
| Reinheit: | Affinity purification |
| Sequenz: | KNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTN |
| Target-Kategorie: | CUL1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:10 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human lung cancer using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates using Cullin 1 Rabbit pAb (A2136) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat lung using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human lung cancer using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat lung using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining. |
|
|
Immunofluorescence analysis of HeLa cells using Cullin 1 Rabbit pAb (A2136). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
Produktgarantie und fachkundiger Support
