USP9X/USP9Y Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20758
Artikelname: USP9X/USP9Y Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20758
Hersteller Artikelnummer: A20758
Alternativnummer: ABB-A20758-20UL,ABB-A20758-100UL,ABB-A20758-500UL,ABB-A20758-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DFFRY, SPGFY2, USP9X/USP9Y
This gene is a member of the peptidase C19 family. It encodes a protein that is similar to ubiquitin-specific proteases, which cleave the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins.
Klonalität: Polyclonal
Molekulargewicht: 291kDa
NCBI: 8287
UniProt: O00507
Reinheit: Affinity purification
Sequenz: YFLERSHSARMTLAKACELCPEEEPDDQDAPDEHEPSPSEDAPLYPHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ
Target-Kategorie: USP9Y
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Immunofluorescence analysis of 293T cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HepG2 cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Western blot analysis of various lysates using USP9X/USP9Y Rabbit pAb (A20758) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time:180s.
Immunofluorescence analysis of NIH/3T3 cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HepG2 cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.