IKKalpha Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A2062
Artikelname: IKKalpha Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A2062
Hersteller Artikelnummer: A2062
Alternativnummer: ABB-A2062-20UL,ABB-A2062-100UL,ABB-A2062-500UL,ABB-A2062-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BPS2, IKK1, IKKA, IKBKA, TCF16, NFKBIKA, IKK-alpha, IKKalpha
This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor.
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 1147
UniProt: O15111
Reinheit: Affinity purification
Sequenz: VLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTP
Target-Kategorie: CHUK
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Protein phosphorylation,Signal Transduction,Kinase,Serine threonine kinases,PI3K-Akt Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Death Receptor Signaling Pathway,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling,Cardiovascular. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Rat liver using IKKalpha Rabbit pAb (A2062) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil using IKKalpha Rabbit pAb (A2062) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Western blot analysis of various lysates, using IKKalpha Rabbit pAb (A2062) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using IKKalpha Rabbit pAb (A2062) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of NIH/3T3 cells using IKKalpha Rabbit pAb (A2062) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using IKKalpha Rabbit pAb (A2062) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using IKKalpha Rabbit pAb (A2062) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200 µg extracts of 293T cells using 3 µg IKKalpha antibody (A2062). Western blot was performed from the immunoprecipitate using IKKalpha antibody (A2062) at a dilution of 1:1000.