[KD Validated] LC3B Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A19665
Artikelname: [KD Validated] LC3B Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A19665
Hersteller Artikelnummer: A19665
Alternativnummer: ABB-A19665-100UL,ABB-A19665-20UL,ABB-A19665-1000UL,ABB-A19665-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LC3B, ATG8F, MAP1LC3B-a, MAP1A/1BLC3, 3B
The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0144]
Molekulargewicht: 15 kDa
NCBI: 81631
UniProt: Q9GZQ8
Reinheit: Affinity purification
Sequenz: PSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDG
Target-Kategorie: MAP1LC3B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:4000|IHC-P,1:100 - 1:500|IF/ICC,1:200 - 1:800|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Cytoskeleton,Microtubules,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience,Cardiovascular,Heart. Shipping: Ice Bag
Western blot analysis of lysates from wild type(WT) and LC3B knockdown (KD) 293T cells, using [KD Validated] LC3B Rabbit mAb (A19665) at 1:1000 dilution. wild type(WT) and LC3B knockdown (KD) 293T cells were treated with Chloroquine (50 µM) at 37°C for 20 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Human brain using [KD Validated] LC3B Rabbit mAb (A19665) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates, using [KD Validated] LC3B Rabbit mAb (A19665) at 1:1000 dilution. 293T, C6 and NIH/3T3 cells were treated with Chloroquine (50 µM) at 37°C for 20 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded Rat brain using [KD Validated] LC3B Rabbit mAb (A19665) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Confocal imaging of HeLa cells (treated with Chloroquine) and HeLa cells (untreated) using [KD Validated] LC3B Rabbit mAb (A19665, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of C6 cells (treated with Chloroquine) and C6 cells (untreated) using [KD Validated] LC3B Rabbit mAb (A19665, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of NIH/3T3 cells (treated with Chloroquine) and NIH/3T3 cells (untreated) using [KD Validated] LC3B Rabbit mAb (A19665, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
Immunoprecipitation analysis of 300 µg extracts from 293T cells using 3 µg [KD Validated] LC3B Rabbit mAb (A19665). Western blot was performed from the immunoprecipitate using LC3B antibody (A19665) at a dilution of 1:1000.