KAP1/TRIM28 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A19568
- Bilder (8)
| Artikelname: | KAP1/TRIM28 Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A19568 |
| Hersteller Artikelnummer: | A19568 |
| Alternativnummer: | ABB-A19568-100UL,ABB-A19568-20UL,ABB-A19568-1000UL,ABB-A19568-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KAP1, TF1B, RNF96, TIF1B, PPP1R157, TIF1beta, KAP1/TRIM28 |
| The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC0047] |
| Molekulargewicht: | 89 kDa |
| NCBI: | 10155 |
| UniProt: | Q13263 |
| Reinheit: | Affinity purification |
| Sequenz: | RNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQVDVKMAILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFAS |
| Target-Kategorie: | TRIM28 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:10000|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Apoptosis,Ubiquitin. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates using KAP1/TRIM28 Rabbit mAb (A19568) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse intestin using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
Produktgarantie und fachkundiger Support
