CEACAM5 Mouse mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A18131
- Bilder (7)
| Artikelname: | CEACAM5 Mouse mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A18131 |
| Hersteller Artikelnummer: | A18131 |
| Alternativnummer: | ABB-A18131-100UL,ABB-A18131-500UL,ABB-A18131-1000UL,ABB-A18131-20UL |
| Hersteller: | ABclonal |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CEA, CD66e, CEACAM5 |
| This gene encodes a cell surface glycoprotein that represents the founding member of the carcinoembryonic antigen (CEA) family of proteins. The encoded protein is used as a clinical biomarker for gastrointestinal cancers and may promote tumor development through its role as a cell adhesion molecule. Additionally, the encoded protein may regulate differentiation, apoptosis, and cell polarity. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Monoclonal |
| Molekulargewicht: | 77kDa |
| NCBI: | 1048 |
| UniProt: | P06731 |
| Reinheit: | Affinity purification |
| Sequenz: | KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNI |
| Target-Kategorie: | CEACAM5 |
| Application Verdünnung: | WB,1:1000 - 1:2000|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Cancer,Tumor immunology,Tumor-associated antigens,Tumor biomarkers,Immunology Inflammation,CDs,Stem Cells,Mesenchymal Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from MCF7 cells, using CEACAM5 Mouse mAb (A18131) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human appendix using CEACAM5 Mouse mAb (A18131) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human esophagus using CEACAM5 Mouse mAb (A18131) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human gastric cancer using CEACAM5 Mouse mAb (A18131) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human hepatocellular carcinoma using CEACAM5 Mouse mAb (A18131) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma using CEACAM5 Mouse mAb (A18131) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human urothelial carcinoma using CEACAM5 Mouse mAb (A18131) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining. |
Produktgarantie und fachkundiger Support
