PNLIPRP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A17520
- Bilder (7)
| Artikelname: | PNLIPRP1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A17520 |
| Hersteller Artikelnummer: | A17520 |
| Alternativnummer: | ABB-A17520-20UL,ABB-A17520-100UL,ABB-A17520-1000UL,ABB-A17520-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PLRP1, PNLIPRP1 |
| Predicted to enable calcium ion binding activity. Predicted to be involved in lipid catabolic process. Predicted to be located in extracellular region. Biomarker of prostate cancer. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 52kDa |
| NCBI: | 5407 |
| UniProt: | P54315 |
| Reinheit: | Affinity purification |
| Sequenz: | FAAYPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEASNFARWRYGVSITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTHSYEFDAKLDVGTIEKVKFLWNNNVINPTLPKVGATKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC |
| Target-Kategorie: | PNLIPRP1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|IF-P,1:50 - 1:200|IHC-P,1:100 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat pancreas using PNLIPRP1 Rabbit pAb (A17520) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human appendix using PNLIPRP1 Rabbit pAb (A17520) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Western blot analysis of various lysates using PNLIPRP1 Rabbit pAb (A17520) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse pancreas using PNLIPRP1 Rabbit pAb (A17520) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunofluorescence analysis of paraffin-embedded rat pancreas using PNLIPRP1 Rabbit pAb (A17520) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of paraffin-embedded rat pancreas using PNLIPRP1 Rabbit pAb (A17520) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of paraffin-embedded mouse pancreas using PNLIPRP1 Rabbit pAb (A17520) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
Produktgarantie und fachkundiger Support
