Filamin A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16376
- Bilder (7)
| Artikelname: | Filamin A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16376 |
| Hersteller Artikelnummer: | A16376 |
| Alternativnummer: | ABB-A16376-100UL,ABB-A16376-20UL,ABB-A16376-1000UL,ABB-A16376-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLN, FMD, MNS, OPD, ABPX, CSBS, CVD1, FGS2, FLN1, NHBP, OPD1, OPD2, XLVD, XMVD, FLN-A, ABP-280, Filamin A |
| The protein encoded by this gene is an actin-binding protein that crosslinks actin filaments and links actin filaments to membrane glycoproteins. The encoded protein is involved in remodeling the cytoskeleton to effect changes in cell shape and migration. This protein interacts with integrins, transmembrane receptor complexes, and second messengers. Defects in this gene are a cause of several syndromes, including periventricular nodular heterotopias (PVNH1, PVNH4), otopalatodigital syndromes (OPD1, OPD2), frontometaphyseal dysplasia (FMD), Melnick-Needles syndrome (MNS), and X-linked congenital idiopathic intestinal pseudoobstruction (CIIPX). Two transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 281kDa |
| NCBI: | 2316 |
| UniProt: | P21333 |
| Reinheit: | Affinity purification |
| Sequenz: | NQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCE |
| Target-Kategorie: | FLNA |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Protein phosphorylation,Signal Transduction,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Actins. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat heart using Filamin A Rabbit pAb (A16376) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human breast cancer using Filamin A Rabbit pAb (A16376) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Western blot analysis of various lysates using Filamin A Rabbit pAb (A16376) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse spleen using Filamin A Rabbit pAb (A16376) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunofluorescence analysis of HeLa cells using Filamin A Rabbit pAb (A16376) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of NIH/3T3 cells using Filamin A Rabbit pAb (A16376) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of PC-12 cells using Filamin A Rabbit pAb (A16376) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
Produktgarantie und fachkundiger Support
