CDK19 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16109
Artikelname: CDK19 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16109
Hersteller Artikelnummer: A16109
Alternativnummer: ABB-A16109-100UL,ABB-A16109-20UL,ABB-A16109-500UL,ABB-A16109-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CDK11, DEE87, CDC2L6, EIEE87, bA346C16.3, CDK19
This gene encodes a protein that is one of the components of the Mediator co-activator complex. The Mediator complex is a multi-protein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 23097
UniProt: Q9BWU1
Reinheit: Affinity purification
Sequenz: QQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGS
Target-Kategorie: CDK19
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Kinase,Cell Biology Developmental Biology,Apoptosis,Cell Cycle. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using CDK19 Rabbit pAb (A16109) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer using CDK19 Rabbit pAb (A16109) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of lysates from DU145 cells, using CDK19 Rabbit pAb (A16109) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human colon using CDK19 Rabbit pAb (A16109) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse stomach using CDK19 Rabbit pAb (A16109) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis using CDK19 Rabbit pAb (A16109) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat testis using CDK19 Rabbit pAb (A16109) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.