S100A8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15315
Artikelname: S100A8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15315
Hersteller Artikelnummer: A15315
Alternativnummer: ABB-A15315-20UL,ABB-A15315-100UL,ABB-A15315-500UL,ABB-A15315-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: P8, MIF, NIF, CAGA, CFAG, CGLA, L1Ag, MRP8, CP-10, MA387, 60B8AG, S100-A8, S100A8
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 11kDa
NCBI: 6279
UniProt: P05109
Reinheit: Affinity purification
Sequenz: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Target-Kategorie: S100A8
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100|IF-P,1:50 - 1:100|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience, Cell Type Marker. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Human tonsil using S100A8 Rabbit pAb (A15315) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver using S100A8 Rabbit pAb (A15315) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Western blot analysis of various lysates using S100A8 Rabbit pAb (A15315) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Human skin using S100A8 Rabbit pAb (A15315) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse spleen using S100A8 Rabbit pAb (A15315) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded human skin cancer using S100A8 Rabbit pAb (A15315) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Confocal immunofluorescence analysis of U-2 OS cells using S100A8 Rabbit pAb (A15315) at dilution of 1:100. Blue: DAPI for nuclear staining.