PRMT5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1520
Artikelname: PRMT5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1520
Hersteller Artikelnummer: A1520
Alternativnummer: ABB-A1520-20UL,ABB-A1520-100UL,ABB-A1520-500UL,ABB-A1520-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HSL7, JBP1, SKB1, IBP72, SKB1Hs, HRMT1L5, PRMT5
This gene encodes an enzyme that belongs to the methyltransferase family. The encoded protein catalyzes the transfer of methyl groups to the amino acid arginine, in target proteins that include histones, transcriptional elongation factors and the tumor suppressor p53. This gene plays a role in several cellular processes, including transcriptional regulation, and the assembly of small nuclear ribonucleoproteins. A pseudogene of this gene has been defined on chromosome 4. Alternative splicing results in multiple transcript variants encoding different isoforms.
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 10419
UniProt: O14744
Reinheit: Affinity purification
Sequenz: MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMH
Target-Kategorie: PRMT5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Human placenta using PRMT5 Rabbit pAb (A1520) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using PRMT5 Rabbit pAb (A1520) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates using PRMT5 Rabbit pAb (A1520) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Immunohistochemistry analysis of paraffin-embedded Rat lung using PRMT5 Rabbit pAb (A1520) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of H9C2 cells using PRMT5 Rabbit pAb (A1520) at dilution of 100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using PRMT5 Rabbit pAb (A1520) at dilution of 100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using PRMT5 Rabbit pAb (A1520) at dilution of 100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.