DAPK3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15047
Artikelname: DAPK3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15047
Hersteller Artikelnummer: A15047
Alternativnummer: ABB-A15047-20UL,ABB-A15047-100UL,ABB-A15047-500UL,ABB-A15047-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DLK, ZIP, ZIPK, DAPK3
Death-associated protein kinase 3 (DAPK3) induces morphological changes in apoptosis when overexpressed in mammalian cells. These results suggest that DAPK3 may play a role in the induction of apoptosis.
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 1613
UniProt: O43293
Reinheit: Affinity purification
Sequenz: MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGE
Target-Kategorie: DAPK3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Kinase,Serine threonine kinases,Cell Biology Developmental Biology,Apoptosis,Death Receptor Signaling Pathway. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Rat kidney using DAPK3 Rabbit pAb (A15047) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung cancer using DAPK3 Rabbit pAb (A15047) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Western blot analysis of various lysates using DAPK3 Rabbit pAb (A15047) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Human placenta using DAPK3 Rabbit pAb (A15047) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using DAPK3 Rabbit pAb (A15047) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of C6 cells using DAPK3 Rabbit pAb (A15047) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using DAPK3 Rabbit pAb (A15047) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.