PP1 beta Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A13528
Artikelname: PP1 beta Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A13528
Hersteller Artikelnummer: A13528
Alternativnummer: ABB-A13528-20UL,ABB-A13528-100UL,ABB-A13528-500UL,ABB-A13528-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MP, PP1B, PP1c, NSLH2, PP-1B, PPP1CD, PP1beta, PPP1beta, HEL-S-80p, PP1 beta
The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 5500
UniProt: P62140
Reinheit: Affinity purification
Sequenz: GADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Target-Kategorie: PPP1CB
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Cancer,Signal Transduction,MAPK-Erk Signaling Pathway,Endocrine Metabolism,Lipid Metabolism,Insulin Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Rat brain using PP1 beta Rabbit pAb (A13528) at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human placenta using PP1 beta Rabbit pAb (A13528) at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates using PP1 beta Rabbit pAb (A13528) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Mouse stomach using PP1 beta Rabbit pAb (A13528) at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of U2OS cells using PP1 beta Rabbit pAb (A13528) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using PP1 beta Rabbit pAb (A13528) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of H9C2 cells using PP1 beta Rabbit pAb (A13528) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.