TEAD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A13366
Artikelname: TEAD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A13366
Hersteller Artikelnummer: A13366
Alternativnummer: ABB-A13366-20UL,ABB-A13366-100UL,ABB-A13366-500UL,ABB-A13366-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AA, REF1, TCF13, TEF-1, NTEF-1, TCF-13, TEAD-1, TEAD1
This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinssons chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 7003
UniProt: P28347
Reinheit: Affinity purification
Sequenz: APSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD
Target-Kategorie: TEAD1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.|ChIP,5µg antibody for 10µg-15µg of Chromatin
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Cell Adhesion,Wnt -Catenin Signaling Pathway,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using TEAD1 Rabbit pAb (A13366) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded Rat brain using TEAD1 Rabbit pAb (A13366) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates using TEAD1 Rabbit pAb (A13366) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer using TEAD1 Rabbit pAb (A13366) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse liver using TEAD1 Rabbit pAb (A13366) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of MCF7 cells using TEAD1 Rabbit pAb (A13366).
Chromatin immunoprecipitation analysis of extracts of HeLa cell line, using TEAD1 rabbit polyclonal antibody (A13366) and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.