YTHDF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A13260
Artikelname: YTHDF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A13260
Hersteller Artikelnummer: A13260
Alternativnummer: ABB-A13260-500UL,ABB-A13260-100UL,ABB-A13260-20UL,ABB-A13260-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DF1, C20orf21, YTHDF1
Enables N6-methyladenosine-containing RNA binding activity and ribosome binding activity. Involved in mRNA destabilization, positive regulation of translational initiation, and stress granule assembly. Located in P-body and cytoplasmic stress granule.
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 54915
UniProt: Q9BYJ9
Reinheit: Affinity purification
Sequenz: MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAV
Target-Kategorie: YTHDF1
Application Verdünnung: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology. Shipping: Ice Bag
Immunofluorescence analysis of L929 cells using YTHDF1 Rabbit pAb (A13260) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using YTHDF1 Rabbit pAb (A13260) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Western blot analysis of various lysates, using YTHDF1 Rabbit pAb (A13260) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using YTHDF1 Rabbit pAb (A13260) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using YTHDF1 Rabbit pAb (A13260) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of L929 cells using YTHDF1 Rabbit pAb (A13260) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using YTHDF1 Rabbit pAb (A13260) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.