YTHDF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A13260
- Bilder (7)
| Artikelname: | YTHDF1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A13260 |
| Hersteller Artikelnummer: | A13260 |
| Alternativnummer: | ABB-A13260-500UL,ABB-A13260-100UL,ABB-A13260-20UL,ABB-A13260-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IP, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DF1, C20orf21, YTHDF1 |
| Enables N6-methyladenosine-containing RNA binding activity and ribosome binding activity. Involved in mRNA destabilization, positive regulation of translational initiation, and stress granule assembly. Located in P-body and cytoplasmic stress granule. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 61kDa |
| NCBI: | 54915 |
| UniProt: | Q9BYJ9 |
| Reinheit: | Affinity purification |
| Sequenz: | MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAV |
| Target-Kategorie: | YTHDF1 |
| Application Verdünnung: | WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Immunofluorescence analysis of L929 cells using YTHDF1 Rabbit pAb (A13260) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of U2OS cells using YTHDF1 Rabbit pAb (A13260) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Western blot analysis of various lysates, using YTHDF1 Rabbit pAb (A13260) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using YTHDF1 Rabbit pAb (A13260) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using YTHDF1 Rabbit pAb (A13260) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunofluorescence analysis of L929 cells using YTHDF1 Rabbit pAb (A13260) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of U2OS cells using YTHDF1 Rabbit pAb (A13260) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
Produktgarantie und fachkundiger Support
