SIRT2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A12575
Artikelname: SIRT2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A12575
Hersteller Artikelnummer: A12575
Alternativnummer: ABB-A12575-100UL,ABB-A12575-20UL,ABB-A12575-1000UL,ABB-A12575-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SIR2, SIR2L, SIR2L2, SIRT2
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Several transcript variants are resulted from alternative splicing of this gene.
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 22933
UniProt: Q8IXJ6
Reinheit: Affinity purification
Sequenz: IMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHA
Target-Kategorie: SIRT2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using SIRT2 Rabbit pAb (A12575) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat kidney using SIRT2 Rabbit pAb (A12575) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Western blot analysis of lysates from Rat brain, using SIRT2 Rabbit pAb (A12575) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.8s.
Immunohistochemistry analysis of paraffin-embedded Human colon using SIRT2 Rabbit pAb (A12575) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of HepG2 cells using SIRT2 Rabbit pAb (A12575) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using SIRT2 Rabbit pAb (A12575) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using SIRT2 Rabbit pAb (A12575) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.