DNA topoisomerase I (TOP1) Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A12409
Artikelname: DNA topoisomerase I (TOP1) Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A12409
Hersteller Artikelnummer: A12409
Alternativnummer: ABB-A12409-100UL,ABB-A12409-20UL,ABB-A12409-500UL,ABB-A12409-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TOPI, DNA topoisomerase I (TOP1)
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0708]
Molekulargewicht: 91kDa
NCBI: 7150
UniProt: P11387
Reinheit: Affinity purification
Sequenz: MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
Target-Kategorie: TOP1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|IF/ICC,1:100 - 1:1000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer. Shipping: Ice Bag
Western blot analysis of lysates from Mouse thymus, using DNA topoisomerase I (DNA topoisomerase I (TOP1)) Rabbit mAb (A12409) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using DNA topoisomerase I (DNA topoisomerase I (TOP1)) Rabbit mAb (A12409) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Western blot analysis of various lysates using DNA topoisomerase I (DNA topoisomerase I (TOP1)) Rabbit mAb (A12409) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Confocal imaging of U-2 OS cells using DNA topoisomerase I (TOP1) Rabbit mAb (A12409,dilution 1:100)(Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012,dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Immunofluorescence analysis of NIH/3T3 cells using DNA topoisomerase I (TOP1) Rabbit mAb (A12409) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of C6 cells using DNA topoisomerase I (TOP1) Rabbit mAb (A12409) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 µg extracts of MCF7 cells using 3 µg DNA topoisomerase I (TOP1) antibody (A12409). Western blot was performed from the immunoprecipitate using DNA topoisomerase I (TOP1) antibody (A12409) at a dilution of 1:1000.