MEF2C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A12385
- Bilder (7)
| Artikelname: | MEF2C Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A12385 |
| Hersteller Artikelnummer: | A12385 |
| Alternativnummer: | ABB-A12385-20UL,ABB-A12385-100UL,ABB-A12385-500UL,ABB-A12385-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NEDHSIL, DEL5q14.3, C5DELq14.3, MEF2C |
| This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe cognitive disability, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 51kDa |
| NCBI: | 4208 |
| UniProt: | Q06413 |
| Reinheit: | Affinity purification |
| Sequenz: | LPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGACTSTHLSQSSNL |
| Target-Kategorie: | MEF2C |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|IF-P,1:50 - 1:100|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Endocrine Metabolism,AMPK Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,Neuroscience,Calcium Signaling,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Heart,Cardiogenesis,Hypertrophy. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from mouse brain, using MEF2C Rabbit pAb (A12385) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human placenta using MEF2C Rabbit pAb (A12385) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Western blot analysis of various lysates using MEF2C Rabbit pAb (A12385) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human endometrium cancer using MEF2C Rabbit pAb (A12385) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat brain using MEF2C Rabbit pAb (A12385) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human breast cancer using MEF2C Rabbit pAb (A12385) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunofluorescence analysis of paraffin-embedded mouse brain using MEF2C Rabbit pAb (A12385) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
Produktgarantie und fachkundiger Support
