GM130 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A11408
- Bilder (7)
| Artikelname: | GM130 Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A11408 |
| Hersteller Artikelnummer: | A11408 |
| Alternativnummer: | ABB-A11408-100UL,ABB-A11408-20UL,ABB-A11408-500UL,ABB-A11408-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GM130, DEDHMB |
| The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC0589] |
| Molekulargewicht: | 113kDa |
| NCBI: | 2801 |
| UniProt: | Q08379 |
| Reinheit: | Affinity purification |
| Sequenz: | MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSM |
| Target-Kategorie: | GOLGA2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|IF/ICC,1:100 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
The STORM super-resolution (SR) imaging of U-2 OS cells using GM130 Rabbit mAb (A11408, ABclonal) at dilution of 1:200 with 3% paraformaldehyde (PFA) +0.1% glutaraldehyde (GA) fixation. The immunostaining was performed by Full Automatic Immunofluorescence Workflow System (Workflow Ultra300, Nano-Micro imaging, China). Image was performed with Single-Molecule Localization Super-Resolution Microscopy (STORM Ultra300, Nano-Micro imaging, China). We acknowledge Nano-Micro imaging Biotechnology Co., Ltd. in SR image processing and kindly providing this image. |
|
|
Western blot analysis of lysates from HeLa cells using GM130 Rabbit mAb (A11408) at 1:1000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
|
|
The STORM super-resolution (SR) imaging of U-2 OS cells using GM130 Rabbit mAb (A11408, ABclonal) at dilution of 1:200 with 3% paraformaldehyde (PFA) +0.1% glutaraldehyde (GA) fixation. The immunostaining was performed by Full Automatic Immunofluorescence Workflow System (Workflow Ultra300, Nano-Micro imaging, China). Image was performed with Single-Molecule Localization Super-Resolution Microscopy (STORM Ultra300, Nano-Micro imaging, China). We acknowledge Nano-Micro imaging Biotechnology Co., Ltd. (宁波纳微成像生科技限公司) in SR image processing and kindly providing this image. |
|
|
Confocal imaging of HeLa cells using GM130RabbitmAb (A11408, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using GM130 Rabbit mAb (A11408) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using GM130 Rabbit mAb (A11408) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using GM130 Rabbit mAb (A11408) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
Produktgarantie und fachkundiger Support
